PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009602925.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 363aa    MW: 41420.3 Da    PI: 9.6365
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009602925.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.4e-15453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW  eEd ll  +vkq+G++ W++++++m+  ++R +k+c +rw +yl
   XP_009602925.1  4 RQRWRSEEDALLRAYVKQYGPKEWHLVSQRMNtaLNRDAKSCLERWKNYL 53
                     89**********************************************97 PP

2Myb_DNA-binding36.21.4e-1159103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
   XP_009602925.1  59 KGSLTEEEQRLVIHLQAKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103
                      6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.921153IPR017930Myb domain
SMARTSM007175.7E-13355IPR001005SANT/Myb domain
SuperFamilySSF466891.94E-21498IPR009057Homeodomain-like
CDDcd001672.14E-8653No hitNo description
Gene3DG3DSA:1.10.10.605.4E-20660IPR009057Homeodomain-like
PfamPF139211.4E-13767No hitNo description
PROSITE profilePS5129423.40254108IPR017930Myb domain
SMARTSM007174.4E-1058106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-1561102IPR009057Homeodomain-like
CDDcd001676.68E-763104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MRERQRWRSE EDALLRAYVK QYGPKEWHLV SQRMNTALNR DAKSCLERWK NYLKPGIKKG  60
SLTEEEQRLV IHLQAKHGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQQRE QKENNKVVDP  120
VDEGKYDHIL ETFAEKIVKE RSVPGLLMAT SNGGFLHADA PAPSPQTLLP PWLSNSTATS  180
TVRSPSPSVT LSLSPSTVPP TPTPTPGIPW LQTDRGPENA PLILSSFPHH GVAPPCGENP  240
FVTELVECCK ELDEGHRAWA AHKKEAAWRL RRVELQLESE KTCKVREKME EIEAKMKALR  300
EEQKATLDRI EAEYKEQLAG LRRDAEAKEQ KLAEQWASKH LRLSKFLEQM GCQSRLAEPN  360
GGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-15792789MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-15792789C-Myb DNA-Binding Domain
1msf_C1e-15792789C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6869330.0JQ686933.1 Nicotiana tabacum cultivar SR1 asymmetric leaves 1 (AS1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009602924.10.0PREDICTED: transcription factor AS1
RefseqXP_009602925.10.0PREDICTED: transcription factor AS1
SwissprotO809311e-170AS1_ARATH; Transcription factor AS1
TrEMBLV9LXP30.0V9LXP3_TOBAC; Asymmetric leaves 1
STRINGPGSC0003DMT4000227710.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-148MYB family protein